
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VAPA Antibody
상품 한눈에 보기
Human VAPA 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC에 적합합니다. siRNA knockdown으로 유전적 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성 제공. Human에 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA009174-100 Anti-VAPA Antibody, VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA009174-25 Anti-VAPA Antibody, VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VAPA Antibody
Anti-VAPA Antibody
VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Genetic validation in WB by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human VAPA.
Alternative Gene Names
- hVAP-33
- VAP-A
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | VAMP (vesicle-associated membrane protein)-associated protein A, 33kDa |
| Target Gene | VAPA |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000014765 (84%), Mouse ENSMUSG00000024091 (60%) |
Antigen Sequence
NDKLGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQKNDMEPSKAVPLNASKQDGPMPKPHSVSLNDTETRKLMEECKRLQGEMMKLSEENRHLRDEGLRLRKVAHSDKPGSTSTASF
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| MSDS | Material Safety Data Sheet |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



