CacheBy
Atlas Antibodies Anti-VARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VARS2 Antibody

상품 한눈에 보기

Human VARS2 단백질을 인식하는 토끼 폴리클로날 항체로, 미토콘드리아 valyl-tRNA synthetase 2 검출에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. ICC 등 다양한 응용에 권장.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA070267-100 Anti-VARS2 Antibody, valyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070267-25 Anti-VARS2 Antibody, valyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VARS2 Antibody

Anti-VARS2 Antibody

Target Protein: valyl-tRNA synthetase 2, mitochondrial
Target Gene: VARS2

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VARS2.

Alternative Gene Names

DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE

Verified Species Reactivity

Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000000833 85%
Mouse ENSMUSG00000038838 85%

Antibody Information

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.