Atlas Antibodies Anti-VARS2 Antibody

상품 한눈에 보기

인간 VARS2 단백질을 인식하는 폴리클로날 항체로, 미토콘드리아 발린-tRNA 합성효소 연구에 적합합니다. 토끼에서 생산되었으며, 프레스트(PrEST) 항원을 이용해 친화 정제되었습니다. 인간에 반응하며, 면역세포 염색 등 다양한 응용에 활용 가능합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA062449-100 Anti-VARS2 Antibody, valyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA062449-25 Anti-VARS2 Antibody, valyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-VARS2 Antibody

Anti-VARS2 Antibody

Target: valyl-tRNA synthetase 2, mitochondrial (VARS2)
Type: Polyclonal Antibody against Human VARS2

Recommended Applications

Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human VARS2 (valyl-tRNA synthetase 2, mitochondrial).
Affinity purified using the PrEST antigen as affinity ligand.

Alternative Gene Names

DKFZP434L1435, G7a, KIAA1885, VARS2L, VARSL

Open Datasheet (PDF)

Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

NALRFILNALGEKFVPQPAEELSPSSPMDAWILSRLALAAQECERGFLTRELSLVTHALHHFWLHNLCDVYLE

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Mouse ENSMUSG00000038838 (85%)
Rat ENSRNOG00000000833 (85%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage	Store at -20°C or below for long-term stability
MSDS	Material Safety Data Sheet