Thermo Fisher Scientific Human CCL19 (MIP-3 beta) Recombinant Protein, PeproTech
Recombinant Human CCL19 (MIP-3β) 단백질로, T 세포 및 수지상세포의 이동 연구에 활용됩니다. E. coli 발현 시스템에서 제조되었으며, ≥98% 순도와 낮은 엔도톡신 수준을 보장합니다. 다양한 in vitro 실험에 적합하며, 동결건조 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): Assay-dependent
- ELISA (ELISA): Assay-dependent
- Functional Assay (Functional): Assay-dependent
- In vitro Assay (IV): -
View 44 publications - Miscellaneous PubMed (Misc): -
View 8 publications
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Published species | Bacteria, Human, Mouse, Zebrafish |
| Expression System | E. coli |
| Amino acid sequence | GTNDAEDCCLSVTQKPIPGYIVRNFHYLLIKDGCRVPAVVFTTLRGRQLCAPPDQPWVERIIQRLQRTSAKMKRRSS |
| Molecular weight | 8.8 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥ 98% (SDS-PAGE, HPLC) |
| Endotoxin concentration | <1 EU/µg |
| Activity | Chemoattracts human T cells at 10–50 ng/ml |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Purification | Purified |
| Contains | No preservative |
| Storage conditions | -20°C |
| Shipping conditions | Ambient |
Product Specific Information
- Catalog No. 300-29B-1MG is provided as 2 × 500 µg (300-29B-500UG).
- Recombinant Human MIP-3β is an 8.8 kDa protein containing 77 amino acids, including four conserved cysteine residues typical of CC chemokines.
- Shipped at ambient temperature. For storage, handling, and reconstitution details, refer to the lot-specific Certificate of Analysis.
Target Information
CCL19 (MIP-3β, Macrophage Inflammatory Protein 3 beta)는 CC 케모카인 서브패밀리에 속하며, CCL21과 32% 아미노산 서열 상동성을 가집니다.
이 두 단백질은 림프절의 T 세포 풍부 영역에서 주로 발현되며, 미성숙 T 세포 및 활성화된 수지상세포의 항상적 이동에 중요한 역할을 합니다. 또한 T 세포의 활성화 및 염증 조직으로의 림프구 유입에도 관여합니다.
CCL19과 CCL21은 모두 CCR7 수용체를 통해 신호를 전달하며, CCL19 결합 시 수용체의 탈감작 및 내재화를 유도합니다.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Human CCL19 (MIP-3 beta) Recombinant Protein, PeproTech
4,596,300원
Thermo Fisher Scientific
Thermo Fisher Scientific Granzyme B (NK/T-Cell Lymphoma Marker) Monoclonal Antibody (GZMB/2403)
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific Human CCL19 (MIP-3 beta) Recombinant Protein, PeproTech
138,900원
Thermo Fisher Scientific
Thermo Fisher Scientific Granzyme B (NK/T-Cell Lymphoma Marker) Monoclonal Antibody (rGZMB/6740)
449,700원
Thermo Fisher Scientific
Thermo Fisher Scientific Human M-CSF Recombinant Protein, PeproTech
138,900원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|