AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UPF3A Antibody
상품 한눈에 보기
Human UPF3A 단백질을 인식하는 Rabbit Polyclonal 항체. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반의 안정한 보존 용액 제공.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA018325-100 Anti-UPF3A Antibody, UPF3 regulator of nonsense transcripts homolog A (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018325-25 Anti-UPF3A Antibody, UPF3 regulator of nonsense transcripts homolog A (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UPF3A Antibody
Anti-UPF3A Antibody
Target: UPF3 regulator of nonsense transcripts homolog A (yeast)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human UPF3A
Alternative Gene Names
HUPF3A, RENT3A, UPF3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UPF3 regulator of nonsense transcripts homolog A (yeast) |
| Target Gene | UPF3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000017397 (47%), Mouse ENSMUSG00000038398 (46%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.