
Atlas Antibodies Anti-UPF3A Antibody
상품 한눈에 보기
Human UPF3A 단백질을 인식하는 Rabbit Polyclonal 항체. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. IHC 등 다양한 응용에 적합하며, 40% glycerol 기반의 안정한 보존 용액 제공.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UPF3A Antibody
Target: UPF3 regulator of nonsense transcripts homolog A (yeast)
Supplier: Atlas Antibodies
Recommended Applications
면역조직화학(IHC) 등 다양한 연구용 응용에 적합
Product Description
Polyclonal Antibody against Human UPF3A
Alternative Gene Names
HUPF3A, RENT3A, UPF3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UPF3 regulator of nonsense transcripts homolog A (yeast) |
| Target Gene | UPF3A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | KARPMEGSLEEPQETSHSGSDKEHRDVERSQEQESEAQRYHVDDGRRHRAHHEPERLSRRSEDEQRWGKGPGQDRGKK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000017397 (47%), Mouse ENSMUSG00000038398 (46%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자가 실험 목적에 맞게 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
