CacheBy
Atlas Antibodies Anti-UNC93A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UNC93A Antibody

상품 한눈에 보기

Human UNC93A 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증된 반응성을 갖습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035729-100 Anti-UNC93A Antibody, unc-93 homolog A (C. elegans) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035729-25 Anti-UNC93A Antibody, unc-93 homolog A (C. elegans) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UNC93A Antibody

Anti-UNC93A Antibody

Target Information

  • Protein: unc-93 homolog A (C. elegans)
  • Gene: UNC93A
  • Alternative Gene Names: dJ366N23.1, dJ366N23.2

Product Description

Polyclonal antibody against human UNC93A.

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR

Verified Species Reactivity

  • Human

Interspecies Information

Species Ortholog ID Sequence Identity
Rat ENSRNOG00000047027 62%
Mouse ENSMUSG00000067049 50%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.