
Atlas Antibodies Anti-UNC93A Antibody
상품 한눈에 보기
Human UNC93A 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 WB 실험에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. 인간에 대해 검증된 반응성을 갖습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UNC93A Antibody
Target Information
- Protein: unc-93 homolog A (C. elegans)
- Gene: UNC93A
- Alternative Gene Names: dJ366N23.1, dJ366N23.2
Product Description
Polyclonal antibody against human UNC93A.
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence: QPIRDVQRESEGEKKSVPFWSTLLSTFKLYRDKR
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000047027 | 62% |
| Mouse | ENSMUSG00000067049 | 50% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UNC5CL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UNC45A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UNC93A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UNC79 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UNC13D Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.