
원본
Atlas Antibodies Anti-UGGT1 Antibody
상품 한눈에 보기
Human UGGT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적 검증 완료. PrEST 항원을 이용해 친화 정제되었으며 Human, Mouse, Rat에 반응. 40% 글리세롤 및 PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA015127-100 Anti-UGGT1 Antibody, UDP-glucose glycoprotein glucosyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA015127-25 Anti-UGGT1 Antibody, UDP-glucose glycoprotein glucosyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UGGT1 Antibody
Anti-UGGT1 Antibody
UDP-glucose glycoprotein glucosyltransferase 1
Recommended Applications
- IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
- WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human UGGT1
Alternative Gene Names
HUGT1, UGCGL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | UDP-glucose glycoprotein glucosyltransferase 1 |
| Target Gene | UGGT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DFILSHAVYCRDVLKLKKGQRAVISNGRIIGPLEDSELFNQDDFHLLENIILKTSGQKIKSHIQQLRVEEDVASDLVMKVDALLSAQPKGDPRIEYQFFEDRHSAIKLRPKEGETYFDVVAVVDPV |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000014901 | 94% |
| Mouse | ENSMUSG00000037470 | 94% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



