
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UFC1 Antibody
상품 한눈에 보기
Human UFC1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB에서 독립적 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human, Mouse, Rat 반응성 확인.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028722-100 Anti-UFC1 Antibody, ubiquitin-fold modifier conjugating enzyme 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028722-25 Anti-UFC1 Antibody, ubiquitin-fold modifier conjugating enzyme 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UFC1 Antibody
Anti-UFC1 Antibody
Target: ubiquitin-fold modifier conjugating enzyme 1 (UFC1)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in western blot (WB) by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human UFC1
Alternative Gene Names
- HSPC155
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-fold modifier conjugating enzyme 1 |
| Target Gene | UFC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000003706 (99%), Mouse ENSMUSG00000062963 (98%) |
Antigen Sequence:
IPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



