
Atlas Antibodies Anti-UFC1 Antibody
상품 한눈에 보기
Human UFC1 단백질을 표적으로 하는 고품질 폴리클로날 항체. IHC 및 WB에서 독립적 검증 완료. Rabbit 유래 IgG, PrEST 항원으로 친화 정제. Human, Mouse, Rat 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UFC1 Antibody
Target: ubiquitin-fold modifier conjugating enzyme 1 (UFC1)
Supplier: Atlas Antibodies
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in immunohistochemistry (IHC) by comparing independent antibodies targeting different epitopes of the protein.WB (Independent Validation)
Validation of protein expression in western blot (WB) by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal Antibody against Human UFC1
Alternative Gene Names
- HSPC155
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-fold modifier conjugating enzyme 1 |
| Target Gene | UFC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human, Mouse, Rat |
| Interspecies Identity | Rat ENSRNOG00000003706 (99%), Mouse ENSMUSG00000062963 (98%) |
Antigen Sequence:
IPITYPTTAPEIAVPELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
