
Atlas Antibodies Anti-UBTF Antibody
상품 한눈에 보기
Human UBTF 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC, ICC 등 다양한 실험에 적합합니다. siRNA knockdown으로 유전적 검증이 완료되었으며, 고순도의 Affinity Purification 방식으로 제조되었습니다. Human 및 Mouse 시료에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBTF Antibody
Target: Upstream Binding Transcription Factor, RNA Polymerase I
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human UBTF.
Alternative Gene Names
NOR-90, UBF, UBF1, UBF2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Upstream binding transcription factor, RNA polymerase I |
| Target Gene | UBTF |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WKLLSQKEKDAYHKKCDQKKKDYEVELLRFLESLPEEEQQRVLGEEKMLNINKKQATSPASKKPAQEGGKGGSEKPKRPVSAMFIFSEEKRRQLQEERPELSESELTRLLARMWNDLSEKKK |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Information | Mouse ENSMUSG00000020923 (98%), Rat ENSRNOG00000020937 (98%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UBXN2B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBXN2A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBTF Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBXN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBXN11 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.