
Atlas Antibodies Anti-UBQLN3 Antibody
Human UBQLN3 단백질을 인식하는 폴리클로날 래빗 항체로, IHC를 통한 단백질 발현 Orthogonal 검증에 적합. PrEST 항원으로 특이적 정제되었으며, 높은 종 특이성과 안정적인 PBS/glycerol 버퍼에 보존됨. UBQLN3 연구 및 단백질 발현 분석에 활용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBQLN3 Antibody
Target Protein: ubiquilin 3
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human UBQLN3
Alternative Gene Names: TUP-1
Target Gene: UBQLN3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
ATEAPRLLLWFMPCLAGTGSVAGGIESREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQDLVSTNPQQLQPEAHFQVQLEQL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000023833 | 70% |
| Mouse | ENSMUSG00000051618 | 67% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UBQLN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBQLN4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBQLN3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBQLN2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBQLN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|