CacheBy
Atlas Antibodies Anti-UBQLN3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBQLN3 Antibody

상품 한눈에 보기

Human UBQLN3 단백질을 인식하는 폴리클로날 래빗 항체로, IHC를 통한 단백질 발현 Orthogonal 검증에 적합. PrEST 항원으로 특이적 정제되었으며, 높은 종 특이성과 안정적인 PBS/glycerol 버퍼에 보존됨. UBQLN3 연구 및 단백질 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020547-100 Anti-UBQLN3 Antibody, ubiquilin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020547-25 Anti-UBQLN3 Antibody, ubiquilin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBQLN3 Antibody

Anti-UBQLN3 Antibody

Target Protein: ubiquilin 3
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human UBQLN3

Alternative Gene Names: TUP-1
Target Gene: UBQLN3
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

ATEAPRLLLWFMPCLAGTGSVAGGIESREDPLMSEDPLPNPPPEVFPALDSAELGFLSPPFLHMLQDLVSTNPQQLQPEAHFQVQLEQL

Open Datasheet


Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000023833 70%
Mouse ENSMUSG00000051618 67%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.