
Atlas Antibodies Anti-UBE3C Antibody
상품 한눈에 보기
Human UBE3C 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 실험에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 기반 PBS 버퍼에 보존제가 포함되어 있습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBE3C Antibody
Target Information
- Protein: Ubiquitin protein ligase E3C
- Gene: UBE3C
- Alternative Gene Names: KIAA0010, KIAA10
Product Description
Polyclonal antibody against human UBE3C, suitable for applications including IHC and ICC.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen
- Antigen Sequence:
VTTSSEMQQCIQMEQKRWIQLFKVITNLVKMLKSRDTRRNFCPPNHWLSEQEDIKADKVTQLYVPASRHVWRFRRMGRIGPLQSTLDVGLESPPLSVSE
Species Reactivity
- Verified Species: Human
- Ortholog Identity:
- Mouse (ENSMUSG00000039000): 96%
- Rat (ENSRNOG00000010702): 96%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Storage Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UBE3A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE3D Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE3C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE4B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE3A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.