
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UBE2M Antibody
상품 한눈에 보기
Human UBE2M 단백질을 인식하는 rabbit polyclonal 항체로, WB, IHC, ICC 등에 적합. Affinity purification으로 높은 특이성과 재현성을 보장하며, glycerol 기반 buffer에 안정화되어 장기 보관 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054551-100 Anti-UBE2M Antibody, ubiquitin-conjugating enzyme E2M 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054551-25 Anti-UBE2M Antibody, ubiquitin-conjugating enzyme E2M 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UBE2M Antibody
Anti-UBE2M Antibody
Target: ubiquitin-conjugating enzyme E2M (UBE2M)
Type: Polyclonal Antibody against Human UBE2M
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent antibody validation available
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human UBE2M.
Alternative Gene Names
- hUbc12
- UBC12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-conjugating enzyme E2M |
| Target Gene | UBE2M |
| Antigen Sequence | LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000005575 (100%), Rat ENSRNOG00000027514 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



