
Atlas Antibodies Anti-UBE2M Antibody
상품 한눈에 보기
Human UBE2M 단백질을 인식하는 rabbit polyclonal 항체로, WB, IHC, ICC 등에 적합. Affinity purification으로 높은 특이성과 재현성을 보장하며, glycerol 기반 buffer에 안정화되어 장기 보관 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-UBE2M Antibody
Target: ubiquitin-conjugating enzyme E2M (UBE2M)
Type: Polyclonal Antibody against Human UBE2M
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) – Independent antibody validation available
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein. - Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human UBE2M.
Alternative Gene Names
- hUbc12
- UBC12
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-conjugating enzyme E2M |
| Target Gene | UBE2M |
| Antigen Sequence | LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000005575 (100%), Rat ENSRNOG00000027514 (100%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-UBE2L6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2L3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2M Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2J1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-UBE2G2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.