Atlas Antibodies Anti-UBE2M Antibody

상품 한눈에 보기

Human UBE2M 단백질을 인식하는 rabbit polyclonal 항체로, WB, IHC, ICC 등에 적합. Affinity purification으로 높은 특이성과 재현성을 보장하며, glycerol 기반 buffer에 안정화되어 장기 보관 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA054551-100 Anti-UBE2M Antibody, ubiquitin-conjugating enzyme E2M 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA054551-25 Anti-UBE2M Antibody, ubiquitin-conjugating enzyme E2M 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ubiquitin-conjugating enzyme E2M (UBE2M)
Type: Polyclonal Antibody against Human UBE2M

Immunohistochemistry (IHC)
Western Blot (WB) – Independent antibody validation available
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Polyclonal antibody raised in rabbit against human UBE2M.

항목	내용
Target Protein	ubiquitin-conjugating enzyme E2M
Target Gene	UBE2M
Antigen Sequence	LEGNVCLNILREDWKPVLTINSIIYGLQYLFLEPNPEDPLNKEAAEVLQNNRRLFEQNVQRSMRGGYIGSTYFERCLK
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000005575 (100%), Rat ENSRNOG00000027514 (100%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)