Atlas Antibodies Anti-UBASH3B Antibody

상품 한눈에 보기

인간 UBASH3B 단백질을 인식하는 고품질 폴리클로날 항체. IHC 등 다양한 응용에 적합. 친화성 정제 방식으로 높은 특이성과 재현성 확보. 토끼 유래 IgG 형식으로 인체 반응 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038607-100 Anti-UBASH3B Antibody, ubiquitin associated and SH3 domain containing B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038607-25 Anti-UBASH3B Antibody, ubiquitin associated and SH3 domain containing B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: ubiquitin associated and SH3 domain containing B (UBASH3B)
Supplier: Atlas Antibodies

면역조직화학(IHC) 등 다양한 생명과학 연구 응용에 적합

Polyclonal Antibody against Human UBASH3B

KIAA1959, STS-1

Target Protein: ubiquitin associated and SH3 domain containing B
Target Gene: UBASH3B
Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

AGSTLPAWIPPSELAAANLSVDTTYRPHIPISKLVVSESYDTYISRSFQVTKEIISECKSKGNNILIVAHASSLEACTCQLQGLSPQNSKDFVQMVR

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand