CacheBy
Atlas Antibodies Anti-UBC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-UBC Antibody

상품 한눈에 보기

인간 UBC 단백질을 인식하는 토끼 폴리클로날 항체. PrEST 항원으로 친화 정제됨. 면역조직화학 등 다양한 응용에 적합. 높은 종간 보존성(인간, 쥐, 랫드 100% 일치). 안정한 PBS/glycerol 버퍼에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA041344-100 Anti-UBC Antibody, ubiquitin C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041344-25 Anti-UBC Antibody, ubiquitin C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-UBC Antibody

Anti-UBC Antibody

Target Information

  • Target Protein: ubiquitin C
  • Target Gene: UBC
  • Antigen Sequence:
    Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQ

Product Description

Polyclonal antibody against human UBC.
Recommended for use in various immunoassays.

Open Datasheet (PDF)

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat: ENSRNOG00000057823 (100%)
  • Mouse: ENSMUSG00000103034 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Material Safety Data Sheet

Immunohistochemistry (IHC) and other immunoassay applications.

제품 이미지

Recommended Applications Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.