
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-UBA1 Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-UBA1 항체는 인간 UBA1 단백질을 인식하는 고품질 rabbit polyclonal antibody입니다. IHC 및 WB에 적합하며, 독립 항체 검증을 통해 높은 신뢰성을 제공합니다. Human, Mouse, Rat 종에서 반응성이 확인되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA001506-100 Anti-UBA1 Antibody, ubiquitin-like modifier activating enzyme 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA001506-25 Anti-UBA1 Antibody, ubiquitin-like modifier activating enzyme 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-UBA1 Antibody
Anti-UBA1 Antibody
Target: ubiquitin-like modifier activating enzyme 1 (UBA1)
Type: Polyclonal Antibody against Human UBA1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Independent Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody raised in rabbit against human UBA1.
Alternative Gene Names
A1S9T, CFAP124, GXP1, POC20, UBE1, UBE1X
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ubiquitin-like modifier activating enzyme 1 |
| Target Gene | UBA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LAAPRHQYYNQEWTLWDRFEVQGLQPNGEEMTLKQFLDYFKTEHKLEITMLSQGVSMLYSFFMPAAKLKERLDQPMTEIVSRVSKRKLGRHVRALVLELCCNDESGEDVEVP |
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000019164 (100%)
- Mouse ENSMUSG00000001924 (100%)
Technical Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



