
Atlas Antibodies Anti-TUBGCP4 Antibody
상품 한눈에 보기
Human TUBGCP4 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse, Rat 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TUBGCP4 Antibody
Target: tubulin, gamma complex associated protein 4
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, recombinant expression validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human TUBGCP4.
Alternative Gene Names
76P, FLJ14797
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | tubulin, gamma complex associated protein 4 |
| Target Gene | TUBGCP4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ILFVGESVQMFENQNVNLTRKGSILKNQEDTFAAELHRLKQQPLFSLVDFEQVVDRIRSTVAEHLWKLMVEESDLLGQLKIIKDFYLLGRGELFQAFIDTAQHMLKTPPTA |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Mouse (ENSMUSG00000027263): 100%
- Rat (ENSRNOG00000012798): 99%
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TUFM Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TUBGCP6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TUBGCP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TUBGCP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TUBD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.