
Atlas Antibodies Anti-TTLL6 Antibody
상품 한눈에 보기
Human TTLL6 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 Orthogonal validation 제공. Rabbit 유래 IgG 형식이며, PrEST 항원 기반 Affinity purification 수행. Human 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TTLL6 Antibody
Target: tubulin tyrosine ligase-like family, member 6
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human TTLL6
Alternative Gene Names
- FLJ35808
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | tubulin tyrosine ligase-like family, member 6 |
| Target Gene | TTLL6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | LLKSDMNKPHLISELLTKLQLSGKLSFFPAHYNPKLGMNNLSQNPSLPGECHSRSDSSGEKRQLDVSSLLLQSPQSYNVTLRDLLVIATPAQLDPRPCRSHASAMRDPCMQDQE |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000004939 (41%), Mouse ENSMUSG00000038756 (41%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TTLL13P Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TTLL4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TTLL6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TTLL5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TTLL3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.