CacheBy
Atlas Antibodies Anti-TTC23 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC23 Antibody

상품 한눈에 보기

Human TTC23 단백질을 인식하는 폴리클로날 토끼 항체. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 높은 종간 특이성 검증 완료.

카탈로그번호
HPA039806-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039806-100 Anti-TTC23 Antibody, tetratricopeptide repeat domain 23 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039806-25 Anti-TTC23 Antibody, tetratricopeptide repeat domain 23 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC23 Antibody

Anti-TTC23 Antibody

Target Information

  • Target Protein: tetratricopeptide repeat domain 23
  • Target Gene: TTC23
  • Alternative Gene Names: FLJ12572, HCC-8
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TTC23.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    LRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000030555 73%
Rat ENSRNOG00000013877 67%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative (Material Safety Data Sheet)

Usage Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.