CacheBy
Atlas Antibodies Anti-TTC21B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC21B Antibody

상품 한눈에 보기

Human TTC21B 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대해 검증되었으며, Mouse 및 Rat과 교차 반응성이 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035495-100 Anti-TTC21B Antibody, tetratricopeptide repeat domain 21B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035495-25 Anti-TTC21B Antibody, tetratricopeptide repeat domain 21B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC21B Antibody

Anti-TTC21B Antibody

Target: tetratricopeptide repeat domain 21B (TTC21B)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TTC21B.

Alternative Gene Names: FLJ11457, IFT139, JBTS11, NPHP12, THM1
Target Protein: tetratricopeptide repeat domain 21B
Target Gene: TTC21B

Open Datasheet (PDF)


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QRLLLQDSQNVEALRMQALYYVCREGDIEKASTKLENLGNALDAMEPQNAQLFYNITLAFSRTCGRSQLILQKIQTLLERAFSLNPQQSEFATELG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000034848 83%
Rat ENSRNOG00000005868 72%

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.