CacheBy
Atlas Antibodies Anti-TTC23 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TTC23 Antibody

상품 한눈에 보기

Human TTC23 단백질에 특이적인 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며, glycerol/PBS buffer로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040369-100 Anti-TTC23 Antibody, tetratricopeptide repeat domain 23 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040369-25 Anti-TTC23 Antibody, tetratricopeptide repeat domain 23 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TTC23 Antibody

Anti-TTC23 Antibody

Target: tetratricopeptide repeat domain 23 (TTC23)
Type: Polyclonal Antibody against Human TTC23


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human TTC23 protein.


Alternative Gene Names

  • FLJ12572
  • HCC-8

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein tetratricopeptide repeat domain 23
Target Gene TTC23
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence LRESLEAKVEAFGDFSPEVAETYRLLGGADLAQGNHSGARKKLKKCLQIQTLLYGPQDKRTLATQQAMGMLSTAPKVASKPRQASKAKVAFCTSIP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000030555 73%
Rat ENSRNOG00000013877 67%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.