AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TSPY1 Antibody
상품 한눈에 보기
사람 TSPY1 단백질을 인식하는 토끼 폴리클로날 항체로, 고환 특이 단백질 연구에 적합. PrEST 항원을 이용해 친화 정제됨. 인체 반응성 검증 완료. 다양한 응용 분야에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067289-100 Anti-TSPY1 Antibody, testis specific protein, Y-linked 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067289-25 Anti-TSPY1 Antibody, testis specific protein, Y-linked 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TSPY1 Antibody
Anti-TSPY1 Antibody
Target: Testis specific protein, Y-linked 1 (TSPY1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TSPY1 protein, designed for applications in testis-specific protein research.
Recommended Applications
- Immunocytochemistry (ICC)
Alternative Gene Names
- CT78
- TSPY
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Testis specific protein, Y-linked 1 |
| Target Gene | TSPY1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000023781 | 38% |
| Mouse | ENSMUSG00000022565 | 38% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.