
Atlas Antibodies Anti-TSPY1 Antibody
상품 한눈에 보기
사람 TSPY1 단백질을 인식하는 토끼 폴리클로날 항체로, 고환 특이 단백질 연구에 적합. PrEST 항원을 이용해 친화 정제됨. 인체 반응성 검증 완료. 다양한 응용 분야에 사용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TSPY1 Antibody
Target: Testis specific protein, Y-linked 1 (TSPY1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TSPY1 protein, designed for applications in testis-specific protein research.
Recommended Applications
- Immunocytochemistry (ICC)
Alternative Gene Names
- CT78
- TSPY
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Testis specific protein, Y-linked 1 |
| Target Gene | TSPY1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | CGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGE |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 | 항원 서열 유사도 |
|---|---|---|
| Rat | ENSRNOG00000023781 | 38% |
| Mouse | ENSMUSG00000022565 | 38% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TSPY4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TSPAN33 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TSPY1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TSPAN31 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TSPO Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.