CacheBy
Atlas Antibodies Anti-GRB2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRB2 Antibody

상품 한눈에 보기

Human GRB2 단백질을 표적으로 하는 폴리클로날 토끼 항체. WB 및 ICC 등 다양한 응용에 적합. PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간, 랫, 마우스 간 교차 반응성 확인됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030749-100 Anti-GRB2 Antibody, growth factor receptor-bound protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030749-25 Anti-GRB2 Antibody, growth factor receptor-bound protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRB2 Antibody

Anti-GRB2 Antibody

Target: Growth factor receptor-bound protein 2 (GRB2)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against human GRB2.


Alternative Gene Names

  • NCKAP2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Growth factor receptor-bound protein 2
Target Gene GRB2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000003990 (100%), Mouse ENSMUSG00000059923 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 성분 비율 및 조건
Glycerol 40%
PBS pH 7.2
Sodium Azide 0.02% (preservative)

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.