CacheBy
Atlas Antibodies Anti-GRB14 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRB14 Antibody

상품 한눈에 보기

Human GRB14 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. PBS와 글리세롤 버퍼에 보존되어 안정적 사용 가능.

카탈로그번호
HPA035053-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035053-100 Anti-GRB14 Antibody, growth factor receptor-bound protein 14 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035053-25 Anti-GRB14 Antibody, growth factor receptor-bound protein 14 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRB14 Antibody

Anti-GRB14 Antibody

Target: Growth factor receptor-bound protein 14 (GRB14)
Supplier: Atlas Antibodies


Immunohistochemistry (IHC)


Product Description

Polyclonal antibody against human GRB14.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Growth factor receptor-bound protein 14
Target Gene GRB14
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PELCCSPFTSVLSADLFPKANSRKKQVIKVYSEDETSRALDVPSDITARDVCQLLILKNHYIDDHSWTLFEHLPHIGVERTIEDHELVIE

Species Reactivity

항목 내용
Verified Reactivity Human
Interspecies Identity Mouse ENSMUSG00000026888 (88%)
Rat ENSRNOG00000052498 (81%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.