Atlas Antibodies Anti-GRB2 Antibody

상품 한눈에 보기

인간 GRB2 단백질을 표적으로 하는 폴리클로날 항체로, WB 및 ICC 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 토끼 유래 IgG 항체로, 인간 시료에서 단백질 발현 검증에 활용 가능.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030750-100 Anti-GRB2 Antibody, growth factor receptor-bound protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030750-25 Anti-GRB2 Antibody, growth factor receptor-bound protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Growth factor receptor-bound protein 2 (GRB2)
Supplier: Atlas Antibodies

WB (Western Blot) – Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human GRB2.

항목	내용
Target Protein	Growth factor receptor-bound protein 2
Target Gene	GRB2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPT
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000003990 (100%), Mouse ENSMUSG00000059923 (98%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand