CacheBy
Atlas Antibodies Anti-GRB10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRB10 Antibody

상품 한눈에 보기

Human GRB10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화정제되었으며, 높은 종간 보존성(쥐·마우스 94%)을 보임. 40% 글리세롤 및 PBS 완충액에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA027502-100 Anti-GRB10 Antibody, growth factor receptor-bound protein 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027502-25 Anti-GRB10 Antibody, growth factor receptor-bound protein 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRB10 Antibody

Anti-GRB10 Antibody

Target: growth factor receptor-bound protein 10 (GRB10)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human GRB10.
Open Datasheet

Target Information

항목 내용
Target Protein growth factor receptor-bound protein 10
Target Gene GRB10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FSGQTGRVIENPAEAQSAALEEGHAWRKRSTRMNILGSQSPLHPSTLSTVIHRTQHWFHGRISREESHRIIKQQGLVDG

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Rat ENSRNOG00000004290 94%
Mouse ENSMUSG00000020176 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Recommended Application: IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.