Atlas Antibodies Anti-GPR162 Antibody

상품 한눈에 보기

인간 GPR162 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반의 Orthogonal 검증을 통해 단백질 발현을 확인할 수 있습니다. 고순도 Affinity 정제 방식으로 제조되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055135-100 Anti-GPR162 Antibody, G protein-coupled receptor 162 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055135-25 Anti-GPR162 Antibody, G protein-coupled receptor 162 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPR162 Antibody

Anti-GPR162 Antibody

Target: G protein-coupled receptor 162 (GPR162)
Type: Polyclonal Antibody against Human GPR162

Recommended Applications

IHC (Orthogonal validation using RNA-seq comparison)
WB (Western Blot)
ICC (Immunocytochemistry)

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody targeting human GPR162, generated in rabbit.

Alternative Gene Names

A-2
GRCA

Open Datasheet (PDF)

Specifications

항목	내용
Target Protein	G protein-coupled receptor 162
Target Gene	GPR162
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL
Verified Species Reactivity	Human
Interspecies Homology	Mouse (97%), Rat (94%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer Composition	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.