
Atlas Antibodies Anti-GPR162 Antibody
상품 한눈에 보기
인간 GPR162 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC, WB, ICC 등 다양한 응용에 적합하며, RNA-seq 데이터 기반의 Orthogonal 검증을 통해 단백질 발현을 확인할 수 있습니다. 고순도 Affinity 정제 방식으로 제조되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPR162 Antibody
Target: G protein-coupled receptor 162 (GPR162)
Type: Polyclonal Antibody against Human GPR162
Recommended Applications
- IHC (Orthogonal validation using RNA-seq comparison)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody targeting human GPR162, generated in rabbit.
Alternative Gene Names
- A-2
- GRCA
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | G protein-coupled receptor 162 |
| Target Gene | GPR162 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | KLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYL |
| Verified Species Reactivity | Human |
| Interspecies Homology | Mouse (97%), Rat (94%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Material Safety Data Sheet (Sodium Azide)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GPR171 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR173 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR162 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR171 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GPR17 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.