
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GPR132 Antibody
상품 한눈에 보기
Human GPR132 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification 방식으로 고순도 확보. IHC 등 다양한 응용에 적합. G2A로도 알려진 GPR132 단백질 검출용. PBS/glycerol buffer에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA029694-100 Anti-GPR132 Antibody, G protein-coupled receptor 132 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029694-25 Anti-GPR132 Antibody, G protein-coupled receptor 132 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GPR132 Antibody
Anti-GPR132 Antibody
Target: G protein-coupled receptor 132 (GPR132, also known as G2A)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human GPR132, generated in rabbit and affinity purified using the PrEST antigen as ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G protein-coupled receptor 132 |
| Target Gene | GPR132 |
| Alternative Gene Names | G2A |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000021298 (54%), Rat ENSRNOG00000013914 (54%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer Composition | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Safety Data Sheet | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
Additional Resources
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



