Atlas Antibodies Anti-GPR132 Antibody

상품 한눈에 보기

Human GPR132 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification 방식으로 고순도 확보. IHC 등 다양한 응용에 적합. G2A로도 알려진 GPR132 단백질 검출용. PBS/glycerol buffer에 보존.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029694-100 Anti-GPR132 Antibody, G protein-coupled receptor 132 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029694-25 Anti-GPR132 Antibody, G protein-coupled receptor 132 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GPR132 Antibody

Anti-GPR132 Antibody

Target: G protein-coupled receptor 132 (GPR132, also known as G2A)
Supplier: Atlas Antibodies

Recommended Applications

Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human GPR132, generated in rabbit and affinity purified using the PrEST antigen as ligand.

Target Information

항목	내용
Target Protein	G protein-coupled receptor 132
Target Gene	GPR132
Alternative Gene Names	G2A
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	HSRQEVSRIHKGWKEWSMKTDVTRLTHSRDTEELQSPVALADHYTFSRPVHPPGSPCPAKRLIEE
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000021298 (54%), Rat ENSRNOG00000013914 (54%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using PrEST antigen
Buffer Composition	40% glycerol, PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety Data Sheet	Material Safety Data Sheet