Atlas Antibodies Anti-GPC5 Antibody
상품 한눈에 보기
Human GPC5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 포함한 단백질 발현 분석에 적합. RNA-seq 데이터와의 정합을 통한 정교한 Orthogonal Validation 제공. PrEST 항원을 이용한 Affinity 정제 방식으로 높은 특이성과 재현성 확보.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GPC5 Antibody
Target Protein: glypican 5 (GPC5)
Supplier: Atlas Antibodies
Recommended Applications
- Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human GPC5.
Validated using enhanced validation methods for high specificity and reliability.
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | glypican 5 |
| Target Gene | GPC5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AELNPHWHAYIRSLEELSDAMHGTYDIGHVLLNFHLLVNDAVLQAHLNGQKLLEQVNRICGRPVRTPTQSPRCSFDQSKEKHGMKTTTRN |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000022112 (88%), Rat ENSRNOG00000057702 (24%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Safety Information | Material Safety Data Sheet |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.