Atlas Antibodies Anti-GOLGA2 Antibody

상품 한눈에 보기

사람 GOLGA2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal 및 Independent validation으로 신뢰성 검증 완료.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA021230-100 Anti-GOLGA2 Antibody, golgin A2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA021230-25 Anti-GOLGA2 Antibody, golgin A2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GOLGA2 Antibody

Anti-GOLGA2 Antibody

Target Protein: golgin A2
Alternative Gene Names: GM130, golgin-95

Recommended Applications

IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 검증
WB (Independent Validation): 서로 다른 epitope을 인식하는 독립 항체와의 비교를 통해 단백질 발현 검증
ICC: 세포 수준에서의 단백질 발현 분석에 사용 가능

Product Description

Polyclonal antibody against human GOLGA2 (golgin A2).

Specifications

항목	내용
Target Gene	GOLGA2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000011884 (79%), Mouse ENSMUSG00000002546 (78%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.