
Atlas Antibodies Anti-GOLGA2 Antibody
상품 한눈에 보기
사람 GOLGA2 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Rabbit 유래 IgG로 제작되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Orthogonal 및 Independent validation으로 신뢰성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GOLGA2 Antibody
Target Protein: golgin A2
Alternative Gene Names: GM130, golgin-95
Recommended Applications
- IHC (Orthogonal Validation): 단백질 발현을 RNA-seq 데이터와 비교하여 고/저 발현 조직 간의 IHC 결과를 검증
- WB (Independent Validation): 서로 다른 epitope을 인식하는 독립 항체와의 비교를 통해 단백질 발현 검증
- ICC: 세포 수준에서의 단백질 발현 분석에 사용 가능
Product Description
Polyclonal antibody against human GOLGA2 (golgin A2).
Specifications
| 항목 | 내용 |
|---|---|
| Target Gene | GOLGA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GDSVCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQSQRAVLKERHREKE |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000011884 (79%), Mouse ENSMUSG00000002546 (78%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Additional Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GOLGA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GOLGA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GOLGA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GOLGA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GNS Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.