Atlas Antibodies Anti-GNS Antibody
상품 한눈에 보기
Human GNS 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. PrEST 항원을 이용한 친화 정제 방식. 재조합 발현 검증 완료. 글리세롤 기반 완충액에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GNS Antibody
Target: glucosamine (N-acetyl)-6-sulfatase (GNS)
Type: Polyclonal Antibody against Human GNS
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human GNS protein.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glucosamine (N-acetyl)-6-sulfatase |
| Target Gene | GNS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (94%), Rat (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.