CacheBy
Atlas Antibodies Anti-GNS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GNS Antibody

상품 한눈에 보기

Human GNS 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. PrEST 항원을 이용한 친화 정제 방식. 재조합 발현 검증 완료. 글리세롤 기반 완충액에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA013695-100 Anti-GNS Antibody, glucosamine (N-acetyl)-6-sulfatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013695-25 Anti-GNS Antibody, glucosamine (N-acetyl)-6-sulfatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GNS Antibody

Anti-GNS Antibody

Target: glucosamine (N-acetyl)-6-sulfatase (GNS)
Type: Polyclonal Antibody against Human GNS


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody raised in rabbit against human GNS protein.
Affinity purified using the PrEST antigen as affinity ligand.

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein glucosamine (N-acetyl)-6-sulfatase
Target Gene GNS
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF
Verified Species Reactivity Human
Interspecies Identity Mouse (94%), Rat (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.