
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GNS Antibody
상품 한눈에 보기
Human GNS 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC에 적합. PrEST 항원을 이용한 친화 정제 방식. 재조합 발현 검증 완료. 글리세롤 기반 완충액에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013695-100 Anti-GNS Antibody, glucosamine (N-acetyl)-6-sulfatase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013695-25 Anti-GNS Antibody, glucosamine (N-acetyl)-6-sulfatase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GNS Antibody
Anti-GNS Antibody
Target: glucosamine (N-acetyl)-6-sulfatase (GNS)
Type: Polyclonal Antibody against Human GNS
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human GNS protein.
Affinity purified using the PrEST antigen as affinity ligand.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glucosamine (N-acetyl)-6-sulfatase |
| Target Gene | GNS |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRF |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (94%), Rat (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



