CacheBy
Atlas Antibodies Anti-GMPPA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GMPPA Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human GMPPA (GDP-mannose pyrophosphorylase A). Affinity purified using PrEST antigen. Suitable for immunohistochemistry and other research applications. Verified reactivity in human, with high sequence identity to m...

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035512-100 Anti-GMPPA Antibody, GDP-mannose pyrophosphorylase A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035512-25 Anti-GMPPA Antibody, GDP-mannose pyrophosphorylase A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GMPPA Antibody

Anti-GMPPA Antibody

Target Information

  • Protein: GDP-mannose pyrophosphorylase A
  • Gene: GMPPA
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    EKPSTFISDIINCGIYLFSPEALKPLRDVFQRNQQDGQLEDSPGLWPGAGTIRLEQDVFSALAGQGQIYVHLTDGIWS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse: ENSMUSG00000033021 (97%)
  • Rat: ENSRNOG00000019946 (97%)

Product Description

Polyclonal antibody against human GMPPA. Recommended for immunohistochemistry and other research applications.

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

관련 문서

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.