CacheBy
Atlas Antibodies Anti-GMDS Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GMDS Antibody

상품 한눈에 보기

인간 GMDS 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Orthogonal 및 Recombinant Expression 검증을 통해 높은 특이성과 신뢰성을 보장하며, 토끼 유래 IgG 형식으로 정제된 고품질 항체입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031528-100 Anti-GMDS Antibody, GDP-mannose 4,6-dehydratase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031528-25 Anti-GMDS Antibody, GDP-mannose 4,6-dehydratase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GMDS Antibody

Anti-GMDS Antibody

Target Protein: GDP-mannose 4,6-dehydratase
Product Type: Polyclonal Antibody against Human GMDS


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody targeting human GMDS, validated in IHC and WB applications.


Alternative Gene Names

GMD, SDR3E1

Open Datasheet (PDF)


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    LAEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYGAAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGAN

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000017605 99%
Mouse ENSMUSG00000038372 99%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
WB Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.