
Atlas Antibodies Anti-GLYAT Antibody
상품 한눈에 보기
Human GLYAT 단백질을 인식하는 폴리클론 항체로, IHC 및 WB 분석에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품. Rabbit에서 생산된 IgG 형 항체로, PrEST 항원 기반 친화 정제 방식 사용.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GLYAT Antibody
Target Protein: glycine-N-acyltransferase
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC) — Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression tissues
- Western Blot (WB)
Product Description
Polyclonal antibody against human GLYAT.
Alternative Gene Names
ACGNAT, GAT
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glycine-N-acyltransferase |
| Target Gene | GLYAT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012142 (68%), Mouse ENSMUSG00000063683 (66%) |
Antigen Sequence:
DQTGEMRMAGTLPEYRLHGLVTYVIYSHAQKLGKLGFPVYSHVDYSNEAMQKMSYTLQHVPIPRSWNQWNCVPL
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GLYAT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLUL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLYAT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLYATL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GLUD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.