CacheBy
Atlas Antibodies Anti-GLRX Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GLRX Antibody

상품 한눈에 보기

인간 GLRX 단백질에 대한 폴리클로날 항체로, IHC 및 Western Blot에 적합합니다. Rabbit에서 생산된 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 특이적으로 반응하며, 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046431-100 Anti-GLRX Antibody, glutaredoxin (thioltransferase) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046431-25 Anti-GLRX Antibody, glutaredoxin (thioltransferase) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GLRX Antibody

Anti-GLRX Antibody

Target Information

  • Target Protein: glutaredoxin (thioltransferase)
  • Target Gene: GLRX
  • Alternative Gene Names: GRX, GRX1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human GLRX.

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Antigen Sequence:
    IQDYLQQLTGARTVPRVFIGKDCIGGCSDLVS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000012183 (97%)
  • Mouse ENSMUSG00000021591 (97%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.
  • Material Safety Data Sheet

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.