
Atlas Antibodies Anti-GIF Antibody
상품 한눈에 보기
인체 GIF 단백질을 인식하는 토끼 다클론 항체로, 위 내인자 및 비타민 B 합성 연구에 적합. IHC 및 WB에 권장되며, 정제된 PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되었으며, RNA-seq 및 재조합 발현 기반 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GIF Antibody
Target: Gastric intrinsic factor (vitamin B synthesis)
Type: Polyclonal Antibody against Human GIF
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression validation): Validation performed using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human GIF (gastric intrinsic factor).
Alternative Gene Names
IF, IFMH, INF, TCN3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Gastric intrinsic factor (vitamin B synthesis) |
| Target Gene | GIF |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024682 (79%), Rat ENSRNOG00000021001 (78%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GIGYF2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GIGYF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GIF Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GIGYF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GID8 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.