
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GIF Antibody
상품 한눈에 보기
인체 GIF 단백질을 인식하는 토끼 다클론 항체로, 위 내인자 및 비타민 B 합성 연구에 적합. IHC 및 WB에 권장되며, 정제된 PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되었으며, RNA-seq 및 재조합 발현 기반 검증 완료.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA040774-100 Anti-GIF Antibody, gastric intrinsic factor (vitamin B synthesis) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040774-25 Anti-GIF Antibody, gastric intrinsic factor (vitamin B synthesis) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GIF Antibody
Anti-GIF Antibody
Target: Gastric intrinsic factor (vitamin B synthesis)
Type: Polyclonal Antibody against Human GIF
Recommended Applications
- IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Recombinant expression validation): Validation performed using target protein overexpression.
Product Description
Polyclonal antibody raised in rabbit against human GIF (gastric intrinsic factor).
Alternative Gene Names
IF, IFMH, INF, TCN3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Gastric intrinsic factor (vitamin B synthesis) |
| Target Gene | GIF |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000024682 (79%), Rat ENSRNOG00000021001 (78%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



