CacheBy
Atlas Antibodies Anti-GIF Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GIF Antibody

상품 한눈에 보기

인체 GIF 단백질을 인식하는 토끼 다클론 항체로, 위 내인자 및 비타민 B 합성 연구에 적합. IHC 및 WB에 권장되며, 정제된 PrEST 항원으로 친화 정제됨. 인간 반응성이 검증되었으며, RNA-seq 및 재조합 발현 기반 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA040774-100 Anti-GIF Antibody, gastric intrinsic factor (vitamin B synthesis) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA040774-25 Anti-GIF Antibody, gastric intrinsic factor (vitamin B synthesis) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GIF Antibody

Anti-GIF Antibody

Target: Gastric intrinsic factor (vitamin B synthesis)
Type: Polyclonal Antibody against Human GIF


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Recombinant expression validation): Validation performed using target protein overexpression.

Product Description

Polyclonal antibody raised in rabbit against human GIF (gastric intrinsic factor).


Alternative Gene Names

IF, IFMH, INF, TCN3

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Gastric intrinsic factor (vitamin B synthesis)
Target Gene GIF
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence TSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNS
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000024682 (79%), Rat ENSRNOG00000021001 (78%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Recombinant Expression

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.