CacheBy
Atlas Antibodies Anti-GGNBP2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GGNBP2 Antibody

상품 한눈에 보기

Human GGNBP2 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산된 IgG 형식입니다. IHC 등 다양한 연구용 응용에 적합하며, 고순도 프레스티지 항원 기반 친화 정제 방식으로 제조되었습니다. PBS/glycerol buffer에 보존제로 sodium azide가 포함되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA018914-100 Anti-GGNBP2 Antibody, gametogenetin binding protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA018914-25 Anti-GGNBP2 Antibody, gametogenetin binding protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGNBP2 Antibody

Anti-GGNBP2 Antibody

Target: Gametogenetin binding protein 2 (GGNBP2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human GGNBP2.


Alternative Gene Names

DIF-3, DIF3, FLJ21230, FLJ22561, LZK1, ZFP403, ZNF403

Open Datasheet (PDF)


Target Information

  • Target Protein: Gametogenetin binding protein 2
  • Target Gene: GGNBP2

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VLRAYNILIGELDCSKEKGYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGRRERHAKTIDIAQEEVLTCLGIHLYERLHRIWQKLRAE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000027860 100%
Mouse ENSMUSG00000020530 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.