Atlas Antibodies Anti-GGPS1 Antibody

상품 한눈에 보기

Human GGPS1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합. Orthogonal 및 Recombinant Expression 검증 완료. Rabbit 유래 IgG 항체이며, 고순도 Affinity 정제. 인체 GGPS1 연구용으로 신뢰성 높은 결과 제공.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029472-100 Anti-GGPS1 Antibody, geranylgeranyl diphosphate synthase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029472-25 Anti-GGPS1 Antibody, geranylgeranyl diphosphate synthase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GGPS1 Antibody

Anti-GGPS1 Antibody

Target: Geranylgeranyl diphosphate synthase 1 (GGPS1)
Supplier: Atlas Antibodies

Recommended Applications

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Recombinant Expression Validation: Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human GGPS1

Alternative Gene Names

GGPPS1

Open Datasheet

Target Information

항목	내용
Target Protein	Geranylgeranyl diphosphate synthase 1
Target Gene	GGPS1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	CEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKE

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000016767 (92%)
Mouse ENSMUSG00000021302 (91%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand