CacheBy
Atlas Antibodies Anti-GGT1 Antibody
원본

Atlas Antibodies Anti-GGT1 Antibody

상품 한눈에 보기

인간 GGT1 단백질을 인식하는 폴리클로나 항체로, WB 및 ICC에 적합합니다. Rabbit 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제되었습니다. 높은 종 간 반응 특이성을 가지며, 연구용으로 최적화된 제품입니다.

카탈로그번호
HPA065444-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065444-100 Anti-GGT1 Antibody, gamma-glutamyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065444-25 Anti-GGT1 Antibody, gamma-glutamyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GGT1 Antibody

Anti-GGT1 Antibody

Target Protein: gamma-glutamyltransferase 1
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human GGT1.


Alternative Gene Names

CD224, D22S672, D22S732, GGT

Open Datasheet


Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MFNSSEQSQKGGLSVAVPGEIRGYELAHQRHG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Mouse ENSMUSG00000006345 84%
Rat ENSRNOG00000047697 69%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

WB Recommended Application
ICC Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.