CacheBy
Atlas Antibodies Anti-GEMIN6 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GEMIN6 Antibody

상품 한눈에 보기

Human GEMIN6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 재조합 발현 검증 완료. 인간에 대한 반응성이 확인되었으며, 마우스 및 랫과 높은 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035726-100 Anti-GEMIN6 Antibody, gem (nuclear organelle) associated protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035726-25 Anti-GEMIN6 Antibody, gem (nuclear organelle) associated protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GEMIN6 Antibody

Anti-GEMIN6 Antibody

Target: gem (nuclear organelle) associated protein 6
Type: Polyclonal Antibody against Human GEMIN6


  • IHC (Immunohistochemistry)
  • WB (Western Blot, Recombinant Expression Validation)

Recombinant expression validation:
Validated in WB using target protein overexpression.


Product Description

Polyclonal antibody raised in rabbit against Human GEMIN6.


Alternative Gene Names

  • FLJ23459

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein gem (nuclear organelle) associated protein 6
Target Gene GEMIN6
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSS
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000055760 (86%), Rat ENSRNOG00000027332 (84%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.