CacheBy
Atlas Antibodies Anti-GEMIN4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GEMIN4 Antibody

상품 한눈에 보기

Human GEMIN4 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG형 항체입니다. WB 및 ICC에 적합하며, RNA-seq 데이터 기반 Orthogonal 검증을 통해 단백질 발현을 확인합니다. PrEST 항원을 이용해 친화 정제되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065699-100 Anti-GEMIN4 Antibody, gem (nuclear organelle) associated protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065699-25 Anti-GEMIN4 Antibody, gem (nuclear organelle) associated protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GEMIN4 Antibody

Anti-GEMIN4 Antibody

Target: gem (nuclear organelle) associated protein 4
Supplier: Atlas Antibodies


  • Western Blot (WB) – Orthogonal validation of protein expression using comparison to RNA-seq data in high and low expression cell lines
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human GEMIN4


Alternative Gene Names

DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97

Open Datasheet (PDF)


Antigen Information

항목 내용
Target Protein gem (nuclear organelle) associated protein 4
Target Gene GEMIN4
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse (84%), Rat (82%)

Antigen Sequence:
DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM


Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.