
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GEMIN6 Antibody
상품 한눈에 보기
Human GEMIN6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화정제되었으며, 40% 글리세롤 기반 완충액에 보존. 인간에 특이적으로 반응하며, 마우스 및 랫과 높은 서열 유사성 보유.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035727-100 Anti-GEMIN6 Antibody, gem (nuclear organelle) associated protein 6 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035727-25 Anti-GEMIN6 Antibody, gem (nuclear organelle) associated protein 6 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GEMIN6 Antibody
Anti-GEMIN6 Antibody
Target: gem (nuclear organelle) associated protein 6
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
Recombinant expression validation: WB에서 타깃 단백질 과발현을 이용한 재조합 발현 검증 완료.
Product Description
Polyclonal antibody against Human GEMIN6.
Alternative Gene Names
- FLJ23459
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | gem (nuclear organelle) associated protein 6 |
| Target Gene | GEMIN6 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSS |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000055760 (86%), Rat ENSRNOG00000027332 (84%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



