
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GEMIN4 Antibody
상품 한눈에 보기
Human GEMIN4 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 ICC에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, PrEST 항원으로 친화 정제되었습니다. Human에 대한 반응성이 검증되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067891-100 Anti-GEMIN4 Antibody, gem (nuclear organelle) associated protein 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067891-25 Anti-GEMIN4 Antibody, gem (nuclear organelle) associated protein 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GEMIN4 Antibody
Anti-GEMIN4 Antibody
Target: gem (nuclear organelle) associated protein 4
Supplier: Atlas Antibodies
Recommended Applications
- WB (Orthogonal validation): Protein expression verified by comparison to RNA-seq data in high and low expression cell lines
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human GEMIN4
Alternative Gene Names
DKFZP434B131, DKFZP434D174, HC56, HCAP1, HHRF-1, p97
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | gem (nuclear organelle) associated protein 4 |
| Target Gene | GEMIN4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DLFFSVGNMIPTINHTILFELLKSLEASGLFIQLLMALPTTICHAELERFLEHVTVDTSAEDVAFFLDVWWEVMKHKGHPQDPLLSQFSAM |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (84%), Rat (82%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS) |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



