CacheBy
Atlas Antibodies Anti-GEMIN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GEMIN2 Antibody

상품 한눈에 보기

Human GEMIN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 RNA-seq 데이터 기반 정합 검증 완료. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤과 PBS 버퍼에 보관. 인간 대상, 마우스·랫과 88% 상동성.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA057114-100 Anti-GEMIN2 Antibody, gem (nuclear organelle) associated protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057114-25 Anti-GEMIN2 Antibody, gem (nuclear organelle) associated protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GEMIN2 Antibody

Anti-GEMIN2 Antibody

Target: gem (nuclear organelle) associated protein 2
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human GEMIN2.


Alternative Gene Names

  • SIP1

Open Datasheet


Target Information

항목 내용
Target Protein gem (nuclear organelle) associated protein 2
Target Gene GEMIN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence QWQQQQVAQFSTVRQNVNKHRSHWKSQQLDSNVTMPKSEDEEGWKKFCLGEKLCADGAVGPATNESPGIDYVQIGFPPLLSIVSRMNQ

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000060121 88%
Rat ENSRNOG00000004360 88%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.