Thermo Fisher Scientific CEP68 Polyclonal Antibody
Rabbit polyclonal antibody targeting human CEP68 protein, validated for Western blot. High purity via antigen affinity chromatography. Supplied lyophilized, reconstitutable to 500 µg/mL. Suitable for research use in human, mouse, and rat samples.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746147 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Centrosomal protein of 68 kDa (CEP68) is encoded by the CEP68 gene in humans and mapped to chromosome 2.
CEP68 is essential for centrosome cohesion and decorates fibres from the proximal ends of centrioles.
CEP68 and rootletin depend on each other for centriole association and both require CEP250 for their function.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Factor D Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Factor D Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CEP68 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CES1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Complement Factor B Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|