Thermo Fisher Scientific CEP68 Polyclonal Antibody
Rabbit polyclonal antibody targeting human CEP68 protein, validated for Western blot. High purity via antigen affinity chromatography. Supplied lyophilized, reconstitutable to 500 µg/mL. Suitable for research use in human, mouse, and rat samples.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CEP68 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746147 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Centrosomal protein of 68 kDa (CEP68) is encoded by the CEP68 gene in humans and mapped to chromosome 2.
CEP68 is essential for centrosome cohesion and decorates fibres from the proximal ends of centrioles.
CEP68 and rootletin depend on each other for centriole association and both require CEP250 for their function.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.