Thermo Fisher Scientific Dectin 1 (soluble) Polyclonal Antibody
Rabbit polyclonal antibody targeting human Dectin 1 (CLEC7A). Recognizes fungal β-glucans for innate immune response research. Supplied as unconjugated liquid at 0.1 mg/mL. Store at 4°C short term or -20°C long term. For research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human CLEC7A (Dectin 1, Clec7a, UniProt ID: Q9BXN2-1, Antigen Range: 72–155) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2790802 |
Product Specific Information
Immunogen sequence: SNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNL
Target Information
CLEC7A, also known as Dectin-1, belongs to the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily and is predominantly expressed on myeloid cells.
It is a small type II membrane glycoprotein receptor with an extracellular C-type lectin-like domain and a cytoplasmic immunoreceptor tyrosine-based activation motif (ITAM).
CLEC7A functions as a pattern-recognition receptor that detects β-1,3-linked and β-1,6-linked glucans from fungi and plants, playing a key role in the innate immune response.
Upon fungal exposure, CLEC7A activates Syk tyrosine kinase, inducing oxidative burst through reactive oxygen species formation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific ZNF587 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific VPS16 Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Dectin 1 (soluble) Polyclonal Antibody
710,700원
Thermo Fisher Scientific
Thermo Fisher Scientific HAGH Polyclonal Antibody
740,000원
Thermo Fisher Scientific
Thermo Fisher Scientific SMC3 Polyclonal Antibody
761,500원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|