Thermo Fisher Scientific Dectin 1 (soluble) Polyclonal Antibody
Rabbit polyclonal antibody targeting human Dectin 1 (CLEC7A). Recognizes fungal β-glucans for innate immune response research. Supplied as unconjugated liquid at 0.1 mg/mL. Store at 4°C short term or -20°C long term. For research use only.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Dectin 1 (soluble) Polyclonal Antibody
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human CLEC7A (Dectin 1, Clec7a, UniProt ID: Q9BXN2-1, Antigen Range: 72–155) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.1 mg/mL |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2790802 |
Product Specific Information
Immunogen sequence: SNSGSNTLENGYFLSRNKENHSQPTQSSLEDSVTPTKAVKTTGVLSSPCPPNWIIYEKSCYLFSMSLNSWDGSKRQCWQLGSNL
Target Information
CLEC7A, also known as Dectin-1, belongs to the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily and is predominantly expressed on myeloid cells.
It is a small type II membrane glycoprotein receptor with an extracellular C-type lectin-like domain and a cytoplasmic immunoreceptor tyrosine-based activation motif (ITAM).
CLEC7A functions as a pattern-recognition receptor that detects β-1,3-linked and β-1,6-linked glucans from fungi and plants, playing a key role in the innate immune response.
Upon fungal exposure, CLEC7A activates Syk tyrosine kinase, inducing oxidative burst through reactive oxygen species formation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.