Thermo Fisher Scientific AFM Polyclonal Antibody
AFM 단백질을 인식하는 Rabbit Polyclonal Antibody로, Western Blot 및 ELISA에 적합합니다. 인간 시료 반응성이 있으며, Affinity Chromatography로 정제되었습니다. PBS/glycerol buffer로 보존되며, -20°C에서 보관합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 1:200–1:2,000 |
| ELISA | 1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 260–599 of human AFM (NP_001124.1) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 2.07 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS, pH 7.3, with 50% glycerol |
| Contains | 0.01% thimerosal |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2854778 |
Product Specific Information
Immunogen sequence:
EDVSSNYDGCCEGDVVQCIRDTSKVMNHICSKQDSISSKIKECCEKKIPERGQCIINSNKDDRPKDLSLREGKFTDSENVCQERDADPDTFFAKFTFEYSRRHPDLSIPELLRIVQIYKDLLRNCCNTENPPGCYRYAEDKFNETTEKSLKMVQQECKHFQNLGKDGLKYHYLIRLTKIAPQLSTEELVSLGEKMVTAFTTCCTLSEEFA CVDNLADLVFGELCGVNENRTINPAVDHCCKTNFAFRRPCFESLKADKTYVPPPFSQDLFTFHADMCQSQNEELQRKTDRFLVNLVKLKHELTDEELQSLFTNFANVVDKCCKAESPEVCFNEESPKIGN
Target Information
This gene belongs to the albumin gene family, which includes four genes located in tandem on chromosome 4. These genes encode structurally related serum transport proteins that are evolutionarily conserved. The AFM protein is developmentally regulated, expressed in the liver, and secreted into the bloodstream.
주의사항
⚠ WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm.
For more information, visit www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific AEBP1 Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific AGMAT Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific AFM Polyclonal Antibody
627,600원
Thermo Fisher Scientific
Thermo Fisher Scientific ADSS Polyclonal Antibody
642,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Centaurin alpha-1 Polyclonal Antibody
627,600원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|