
Atlas Antibodies Anti-TRPV2 Antibody
Human TRPV2 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 대해 검증된 반응성을 보유하고 있으며, VRL, VRL1 등 대체 유전자명으로도 알려짐.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRPV2 Antibody
Target: transient receptor potential cation channel, subfamily V, member 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TRPV2.
Alternative Gene Names
VRL, VRL-1, VRL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transient receptor potential cation channel, subfamily V, member 2 |
| Target Gene | TRPV2 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (71%), Rat (59%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRUB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRUB2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPV2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRPV5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|