
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-TRPV2 Antibody
상품 한눈에 보기
Human TRPV2 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 친화 정제됨. Human에 대해 검증된 반응성을 보유하고 있으며, VRL, VRL1 등 대체 유전자명으로도 알려짐.
- 카탈로그번호
- HPA044993-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044993-100 Anti-TRPV2 Antibody, transient receptor potential cation channel, subfamily V, member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044993-25 Anti-TRPV2 Antibody, transient receptor potential cation channel, subfamily V, member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-TRPV2 Antibody
Anti-TRPV2 Antibody
Target: transient receptor potential cation channel, subfamily V, member 2
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TRPV2.
Alternative Gene Names
VRL, VRL-1, VRL1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | transient receptor potential cation channel, subfamily V, member 2 |
| Target Gene | TRPV2 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (71%), Rat (59%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | RGKLDFGSGLPPMESQFQGEDRKFAPQIRVNLNYRKGTGASQPDPNRFDRDRLFNAVSRGVPEDLAGLPEYLSKTSKYLTDS |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



