
Atlas Antibodies Anti-TRIM39 Antibody
상품 한눈에 보기
Human TRIM39 단백질을 인식하는 rabbit polyclonal antibody로, IHC 및 ICC에 적합. RNF23로도 알려진 TRIM39을 표적으로 하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대해 검증된 반응성을 가지며, glycerol/PBS buffer로 안정화됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRIM39 Antibody
Target Information
- Target Protein: Tripartite motif containing 39
- Target Gene: TRIM39
- Alternative Gene Name: RNF23
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human TRIM39.
Antigen Information
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSMVEIAKQLQAVKRKIRDESLCPQHHEALSLFCYEDQEAVCLICAISHTHRAHTVVPLDDATQEYKE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000000785 | 94% |
| Mouse | ENSMUSG00000045409 | 93% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer Composition | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRIM4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM38 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM39 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM37 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM36 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.