
Atlas Antibodies Anti-TRIM26 Antibody
상품 한눈에 보기
Human TRIM26 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 ICC에 적합하며, Affinity purification 방식으로 정제됨. RNF95, ZNF173 등 대체 유전자명과 함께 Human에 대한 반응성이 검증됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRIM26 Antibody
Target Information
- Target Protein: tripartite motif containing 26
- Target Gene: TRIM26
- Alternative Gene Names: RNF95, ZNF173
Product Description
Polyclonal antibody against Human TRIM26.
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
ESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKKLQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGRE
Verified Species Reactivity
- Human
Interspecies Information
| Species | Ortholog ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000024457 | 88% |
| Rat | ENSRNOG00000032930 | 88% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
- Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRIM27 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM25 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM26 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRIM24 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.