
Atlas Antibodies Anti-TRERF1 Antibody
Human TRERF1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification 방식으로 정제되어 높은 특이성과 재현성을 제공. ICC 등 다양한 응용에 적합하며, Human에 대한 검증 완료.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-TRERF1 Antibody
Target Protein: Transcriptional Regulating Factor 1 (TRERF1)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human TRERF1, also known as transcriptional regulating factor 1.
Validated for use in immunocytochemistry (ICC) and other related applications.
Alternative Gene Names
BCAR2, dJ139D8.5, HSA277276, RAPA, TReP-132
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
QGSGLFSNVLISGHGPGAHPQLPLTPLTPTPRVLLCRSNSIDGSNVTVTPGPGEQTVDVEPRINIGLRFQAEIPELQDISALAQDTHKATLVWKPWPELENHDLQQRVENLLNLCC
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000022598 | 94% |
| Mouse | ENSMUSG00000042507 | 48% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-TRERF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TREX1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRERF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TRERF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-TREML4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|